Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.1: Thioltransferase [52834] (16 proteins) |
Protein Thioredoxin [52835] (15 species) |
Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries) |
Domain d1auca_: 1auc A: [32747] |
PDB Entry: 1auc (more details), 2.1 Å
SCOPe Domain Sequences for d1auca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auca_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
Timeline for d1auca_: