SCOPe 2.06: Domain d5m94d_: 5m94 D:

Lineage for d5m94d_ (5m94 D:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5m94d_: 5m94 D: [327468]
   automated match to d2p49b_

Details for d5m94d_

PDB Entry: 5m94, 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody

PDB Compounds: (D:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d5m94d_:

Sequence; same for both SEQRES and ATOM records:

>d5m94d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

Timeline for d5m94d_:

• d5m94d_ is new in SCOPe 2.06-stable
  
• d5m94d_ appears in SCOPe 2.07
  
• d5m94d_ appears in the current release, SCOPe 2.08