SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m94d_ (5m94 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (128 PDB entries)
  8. 2284167Domain d5m94d_: 5m94 D: [327468]
    automated match to d2p49b_

Details for d5m94d_

PDB Entry: 5m94 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody
PDB Compounds: (D:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d5m94d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m94d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

SCOPe Domain Coordinates for d5m94d_:

Click to download the PDB-style file with coordinates for d5m94d_.
(The format of our PDB-style files is described here.)

Timeline for d5m94d_:

  • d5m94d_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from other chains:
(mouse over for more information)
d5m94b_