Lineage for d5m94d_ (5m94 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2020007Species Llama (Lama glama) [TaxId:9844] [187485] (134 PDB entries)
  8. 2284167Domain d5m94d_: 5m94 D: [327468]
    automated match to d2p49b_

Details for d5m94d_

PDB Entry: 5m94 (more details), 3.1 Å

PDB Description: crystal structure of staphylococcus capitis divalent metal ion transporter (dmt) in complex with nanobody
PDB Compounds: (D:) Camelid antibody fragment, nanobody

SCOPe Domain Sequences for d5m94d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m94d_ b.1.1.1 (D:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlqesggglvqaggslrlscaasrsifsidtanwyrqppgmqrelvatitrdgnanyad
svkgrftisrdrarntvylqmnslkpedtgvyycnaairttvrtsaqeywgqgtqvtvss

SCOPe Domain Coordinates for d5m94d_:

Click to download the PDB-style file with coordinates for d5m94d_.
(The format of our PDB-style files is described here.)

Timeline for d5m94d_:

  • d5m94d_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from other chains:
(mouse over for more information)
d5m94b_