SCOPe 2.08: Domain d5life_: 5lif E:

Lineage for d5life_ (5lif E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
   includes alpha-helical C-terminal domain characteristic for the family

6. Protein Thermolysin [63414] (3 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
   Uniprot P00800

8. Domain d5life_: 5lif E: [327464]
   automated match to d1kkka_
   complexed with 6xo, ca, dms, gol, zn

Details for d5life_

PDB Entry: 5lif, 1.31 Å

PDB Description: thermolysin in complex with inhibitor

PDB Compounds: (E:) thermolysin

SCOPe Domain Sequences for d5life_:

Sequence; same for both SEQRES and ATOM records:

>d5life_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

Timeline for d5life_:

• d5life_ first appeared in SCOPe 2.06
  
• d5life_ appears in SCOPe 2.07