SCOPe 2.06: Domain d5ltpe1: 5ltp E:1-219

Lineage for d5ltpe1 (5ltp E:1-219)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)

8. Domain d5ltpe1: 5ltp E:1-219 [327462]
   Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2
   automated match to d3neda_
   complexed with cl, flc

Details for d5ltpe1

PDB Entry: 5ltp, 1.7 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the acidic ph 4.5

PDB Compounds: (E:) mNeonGreen

SCOPe Domain Sequences for d5ltpe1:

Sequence; same for both SEQRES and ATOM records:

>d5ltpe1 d.22.1.0 (E:1-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
aslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphigyg
fhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvkgt
gfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfakp
maanylknqpmyvfrktelkhsktelnfkewqkaftdvm

Timeline for d5ltpe1:

• d5ltpe1 is new in SCOPe 2.06-stable
  
• d5ltpe1 appears in SCOPe 2.07
  
• d5ltpe1 appears in the current release, SCOPe 2.08