SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ltpa_ (5ltp A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165337Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2284149Domain d5ltpa_: 5ltp A: [327450]
    Other proteins in same PDB: d5ltpb2, d5ltpc2, d5ltpd2, d5ltpe2, d5ltpf2
    automated match to d3neda_
    complexed with cl, flc

Details for d5ltpa_

PDB Entry: 5ltp (more details), 1.7 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the acidic ph 4.5
PDB Compounds: (A:) mNeonGreen

SCOPe Domain Sequences for d5ltpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltpa_ d.22.1.0 (A:) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
ednmaslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvph
igygfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaq
vkgtgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttyt
fakpmaanylknqpmyvfrktelkhsktelnfkewqkaftd

SCOPe Domain Coordinates for d5ltpa_:

Click to download the PDB-style file with coordinates for d5ltpa_.
(The format of our PDB-style files is described here.)

Timeline for d5ltpa_:

  • d5ltpa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22