SCOPe 2.06: Domain d1erwa_: 1erw A:

Lineage for d1erwa_ (1erw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (30 PDB entries)

8. Domain d1erwa_: 1erw A: [32745]
   mutant

Details for d1erwa_

PDB Entry: 1erw, 1.8 Å

PDB Description: human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d1erwa_:

Sequence; same for both SEQRES and ATOM records:

>d1erwa_ c.47.1.1 (A:) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}
mvkqiesktafqealdaagdklvvvdfsatwsgpskmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d1erwa_:

• d1erwa_ first appeared (with stable ids) in SCOP 1.55, called d1erw__
  
• d1erwa_ appears in SCOPe 2.05
  
• d1erwa_ appears in SCOPe 2.07
  
• d1erwa_ appears in the current release, SCOPe 2.08