SCOP 1.65: Domain d1erw__: 1erw -

Lineage for d1erw__ (1erw -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.1: Thioltransferase [52834] (7 proteins)

6. Protein Thioredoxin [52835] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries)

8. Domain d1erw__: 1erw - [32745]
   mutant

Details for d1erw__

PDB Entry: 1erw, 1.8 Å

PDB Description: human thioredoxin double mutant with cys 32 replaced by ser and cys 35 replaced by ser

SCOP Domain Sequences for d1erw__:

Sequence; same for both SEQRES and ATOM records:

>d1erw__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwsgpskmikpffhslsekysnviflevdvd
dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv

Timeline for d1erw__:

• d1erw__ first appeared (with stable ids) in SCOP 1.55
  
• d1erw__ appears in SCOP 1.63
  
• d1erw__ appears in SCOP 1.67
  
• d1erw__ appears in the current release, SCOPe 2.08, called d1erwa_