Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.1: Thioltransferase [52834] (7 proteins) |
Protein Thioredoxin [52835] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [52842] (18 PDB entries) |
Domain d1erw__: 1erw - [32745] mutant |
PDB Entry: 1erw (more details), 1.8 Å
SCOP Domain Sequences for d1erw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1erw__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)} mvkqiesktafqealdaagdklvvvdfsatwsgpskmikpffhslsekysnviflevdvd dcqdvasecevkcmptfqffkkgqkvgefsgankekleatinelv
Timeline for d1erw__: