Lineage for d5liea_ (5lie A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (62 species)
    not a true protein
  7. 2273662Species Mycobacterium tuberculosis [TaxId:1773] [316963] (2 PDB entries)
  8. 2284147Domain d5liea_: 5lie A: [327448]
    automated match to d4apya_
    complexed with hem, imd

Details for d5liea_

PDB Entry: 5lie (more details), 1.8 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp126a1 in complex with imidazole
PDB Compounds: (A:) Putative cytochrome P450 126

SCOPe Domain Sequences for d5liea_:

Sequence, based on SEQRES records: (download)

>d5liea_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgfdfrgsr
ratmprlnvedagsrlytyaleliagkraepaddmlsvvanatiddpdapalsdaelylf
fhllfsagaettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtspspskrrt
asravslggqpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgvhyclga
nlarlelrvlfeellsrfgsvrvvepaewtrsnrhtgirhlvvelr

Sequence, based on observed residues (ATOM records): (download)

>d5liea_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavvedagsrlyt
yaleliagkraepaddmlsvvanalsdaelylffhllfsagaettrnsiaggllalaenp
dqlqtlrsdfellptaieeivrwtspspskrrtasravslggqpieagqkvvvwegsanr
dpsvfdradefditrkpnphlgfgqgvhyclganlarlelrvlfeellsrfgsvrvvepa
ewtrsnrhtgirhlvvelr

SCOPe Domain Coordinates for d5liea_:

Click to download the PDB-style file with coordinates for d5liea_.
(The format of our PDB-style files is described here.)

Timeline for d5liea_:

  • d5liea_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22