SCOPe 2.08: Domain d5icta1: 5ict A:3-266

Lineage for d5icta1 (5ict A:3-266)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [323396] (2 PDB entries)

8. Domain d5icta1: 5ict A:3-266 [327446]
   Other proteins in same PDB: d5icta2
   automated match to d5ftia_
   complexed with glu, gol; mutant

Details for d5icta1

PDB Entry: 5ict, 1.68 Å

PDB Description: crystal structure of the drosophila glur1a ligand binding domain y792t mutant complex with glutamate

PDB Compounds: (A:) Glutamate receptor 1

SCOPe Domain Sequences for d5icta1:

Sequence; same for both SEQRES and ATOM records:

>d5icta1 c.94.1.1 (A:3-266) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ydrnhtyivsslleepylslkqytygeslvgndrfegyckdladmlaaqlgikyeirlvq
dgnygaenqyapggwdgmvgelirkeadiaisamtitaerervidfskpfmtlgisimik
kgtpiktpedltmqtdvnygtllygstweffrrsqiglhnkmweymnanqhhsvhttdeg
irrvrqskgkyallvespkneyvnarppcdtmkvgrnidtkgfgvatpigsplrkrlnea
vltlkengellrirnkwwfdktec

Timeline for d5icta1:

• d5icta1 first appeared in SCOPe 2.06
  
• d5icta1 appears in SCOPe 2.07