SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5icta1 (5ict A:3-266)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (25 species)
    not a true protein
  7. 2280095Species Drosophila melanogaster [TaxId:7227] [323396] (2 PDB entries)
  8. 2284145Domain d5icta1: 5ict A:3-266 [327446]
    Other proteins in same PDB: d5icta2
    automated match to d5ftia_
    complexed with glu, gol; mutant

Details for d5icta1

PDB Entry: 5ict (more details), 1.68 Å

PDB Description: crystal structure of the drosophila glur1a ligand binding domain y792t mutant complex with glutamate
PDB Compounds: (A:) Glutamate receptor 1

SCOPe Domain Sequences for d5icta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icta1 c.94.1.1 (A:3-266) automated matches {Drosophila melanogaster [TaxId: 7227]}
ydrnhtyivsslleepylslkqytygeslvgndrfegyckdladmlaaqlgikyeirlvq
dgnygaenqyapggwdgmvgelirkeadiaisamtitaerervidfskpfmtlgisimik
kgtpiktpedltmqtdvnygtllygstweffrrsqiglhnkmweymnanqhhsvhttdeg
irrvrqskgkyallvespkneyvnarppcdtmkvgrnidtkgfgvatpigsplrkrlnea
vltlkengellrirnkwwfdktec

SCOPe Domain Coordinates for d5icta1:

Click to download the PDB-style file with coordinates for d5icta1.
(The format of our PDB-style files is described here.)

Timeline for d5icta1:

  • d5icta1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5icta2