SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l7ta1 (5l7t A:4-256)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (50 species)
    not a true protein
  7. 2091971Species Human (Homo sapiens) [TaxId:9606] [186828] (18 PDB entries)
  8. 2284137Domain d5l7ta1: 5l7t A:4-256 [327438]
    Other proteins in same PDB: d5l7ta2
    automated match to d1ydef_
    complexed with 6qj, na, nad

Details for d5l7ta1

PDB Entry: 5l7t (more details), 1.98 Å

PDB Description: 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor.
PDB Compounds: (A:) 17-beta-hydroxysteroid dehydrogenase 14

SCOPe Domain Sequences for d5l7ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l7ta1 c.2.1.2 (A:4-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv
tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk
lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis
pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel
lvtggaelgygck

SCOPe Domain Coordinates for d5l7ta1:

Click to download the PDB-style file with coordinates for d5l7ta1.
(The format of our PDB-style files is described here.)

Timeline for d5l7ta1:

  • d5l7ta1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5l7ta2