SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5li6a_ (5li6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (58 species)
    not a true protein
  7. 2284134Species Mycobacterium tuberculosis [TaxId:83331] [327435] (3 PDB entries)
  8. 2284135Domain d5li6a_: 5li6 A: [327436]
    automated match to d4apya_
    complexed with 6xf, hem

Details for d5li6a_

PDB Entry: 5li6 (more details), 1.95 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp126a1 in complex with n-isopropyl-n-((3-(4-methoxyphenyl)-1,2,4-oxadiazol-5-yl) methyl)-2-(4-nitrophenyl)acetamide
PDB Compounds: (A:) Putative cytochrome P450 126

SCOPe Domain Sequences for d5li6a_:

Sequence, based on SEQRES records: (download)

>d5li6a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgfdfrgsr
ratmprlnvedagsrlytyaleliagkraepaddmlsvvanatiddpdapalsdaelylf
fhllfsagaettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtspspskrrt
asravslggqpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgvhyclga
nlarlelrvlfeellsrfgsvrvvepaewtrsnrhtgirhlvvelr

Sequence, based on observed residues (ATOM records): (download)

>d5li6a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavdagsrlytya
leliagkraepaddmlsvvanalsdaelylffhllfsagaettrnsiaggllalaenpdq
lqtlrsdfellptaieeivrwtspspskrrtasravslggqpieagqkvvvwegsanrdp
svfdradefditrkpnphlgfgqgvhyclganlarlelrvlfeellsrfgsvrvvepaew
trsnrhtgirhlvvelr

SCOPe Domain Coordinates for d5li6a_:

Click to download the PDB-style file with coordinates for d5li6a_.
(The format of our PDB-style files is described here.)

Timeline for d5li6a_:

  • d5li6a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22