Lineage for d5li6a_ (5li6 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (62 species)
    not a true protein
  7. 2284134Species Mycobacterium tuberculosis [TaxId:83331] [327435] (3 PDB entries)
  8. 2284135Domain d5li6a_: 5li6 A: [327436]
    automated match to d4apya_
    complexed with 6xf, hem

Details for d5li6a_

PDB Entry: 5li6 (more details), 1.95 Å

PDB Description: crystal structure of mycobacterium tuberculosis cyp126a1 in complex with n-isopropyl-n-((3-(4-methoxyphenyl)-1,2,4-oxadiazol-5-yl) methyl)-2-(4-nitrophenyl)acetamide
PDB Compounds: (A:) Putative cytochrome P450 126

SCOPe Domain Sequences for d5li6a_:

Sequence, based on SEQRES records: (download)

>d5li6a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavepgfdfrgsr
ratmprlnvedagsrlytyaleliagkraepaddmlsvvanatiddpdapalsdaelylf
fhllfsagaettrnsiaggllalaenpdqlqtlrsdfellptaieeivrwtspspskrrt
asravslggqpieagqkvvvwegsanrdpsvfdradefditrkpnphlgfgqgvhyclga
nlarlelrvlfeellsrfgsvrvvepaewtrsnrhtgirhlvvelr

Sequence, based on observed residues (ATOM records): (download)

>d5li6a_ a.104.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83331]}
lsgidltdldnfadgfphhlfaihrreapvywhrptehtpdgegfwsvatyaetlevlrd
pvtyssvtggqrrfggtvlqdlpvagqvlnmmddprhtrirrlvssgltprmirrveddl
rrrarglldgvepgapfdfvveiaaelpmqmicillgvpetdrhwlfeavdagsrlytya
leliagkraepaddmlsvvanalsdaelylffhllfsagaettrnsiaggllalaenpdq
lqtlrsdfellptaieeivrwtspspskrrtasravslggqpieagqkvvvwegsanrdp
svfdradefditrkpnphlgfgqgvhyclganlarlelrvlfeellsrfgsvrvvepaew
trsnrhtgirhlvvelr

SCOPe Domain Coordinates for d5li6a_:

Click to download the PDB-style file with coordinates for d5li6a_.
(The format of our PDB-style files is described here.)

Timeline for d5li6a_:

  • d5li6a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22