Lineage for d1erv__ (1erv -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24160Species Human (Homo sapiens) [TaxId:9606] [52842] (17 PDB entries)
  8. 24161Domain d1erv__: 1erv - [32743]

Details for d1erv__

PDB Entry: 1erv (more details), 1.65 Å

PDB Description: human thioredoxin mutant with cys 73 replaced by ser (reduced form)

SCOP Domain Sequences for d1erv__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erv__ c.47.1.1 (-) Thioredoxin {Human (Homo sapiens)}
mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv

SCOP Domain Coordinates for d1erv__:

Click to download the PDB-style file with coordinates for d1erv__.
(The format of our PDB-style files is described here.)

Timeline for d1erv__: