SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9kl1 (5k9k L:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (21 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (164 PDB entries)
  8. 2284126Domain d5k9kl1: 5k9k L:1-106 [327427]
    Other proteins in same PDB: d5k9kb2, d5k9kf1, d5k9kf2, d5k9ki1, d5k9ki2, d5k9kl2
    automated match to d1dn0a1
    complexed with bma, man, nag

Details for d5k9kl1

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (L:) 56.a.09 light chain

SCOPe Domain Sequences for d5k9kl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9kl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvassylawyqqkpgqaprlliygassratgvp
drfsgsgsgtdfiltisrlepedfavyycqqydgsqytfgqgtklei

SCOPe Domain Coordinates for d5k9kl1:

Click to download the PDB-style file with coordinates for d5k9kl1.
(The format of our PDB-style files is described here.)

Timeline for d5k9kl1:

  • d5k9kl1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22