SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l6yc_ (5l6y C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991528Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)
  6. 1991554Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 1991555Species Human (Homo sapiens) [TaxId:9606] [63533] (12 PDB entries)
  8. 2284124Domain d5l6yc_: 5l6y C: [327425]
    Other proteins in same PDB: d5l6yl1, d5l6yl2
    automated match to d5e4ea_
    complexed with fmt

Details for d5l6yc_

PDB Entry: 5l6y (more details), 1.99 Å

PDB Description: il13 in complex with tralokinumab
PDB Compounds: (C:) interleukin-13

SCOPe Domain Sequences for d5l6yc_:

Sequence, based on SEQRES records: (download)

>d5l6yc_ a.26.1.2 (C:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
rmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn

Sequence, based on observed residues (ATOM records): (download)

>d5l6yc_ a.26.1.2 (C:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
ppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektq
rmlsgfcdtkievaqfvkdlllhlkklfregrfn

SCOPe Domain Coordinates for d5l6yc_:

Click to download the PDB-style file with coordinates for d5l6yc_.
(The format of our PDB-style files is described here.)

Timeline for d5l6yc_:

  • d5l6yc_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22