SCOPe 2.08: Domain d5iukc1: 5iuk C:1-131

Lineage for d5iukc1 (5iuk C:1-131)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)

8. Domain d5iukc1: 5iuk C:1-131 [327421]
   Other proteins in same PDB: d5iukc2, d5iukf2
   automated match to d4le0b_
   complexed with acp, k, mg

Details for d5iukc1

PDB Entry: 5iuk, 2.9 Å

PDB Description: crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)

PDB Compounds: (C:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iukc1:

Sequence; same for both SEQRES and ATOM records:

>d5iukc1 c.23.1.0 (C:1-131) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedl

Timeline for d5iukc1:

• d5iukc1 first appeared in SCOPe 2.06
  
• d5iukc1 appears in SCOPe 2.07