SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iukc1 (5iuk C:1-131)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (68 species)
    not a true protein
  7. 2101986Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2284120Domain d5iukc1: 5iuk C:1-131 [327421]
    Other proteins in same PDB: d5iukc2, d5iukf2
    automated match to d4le0b_
    complexed with acp, k, mg

Details for d5iukc1

PDB Entry: 5iuk (more details), 2.9 Å

PDB Description: crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)
PDB Compounds: (C:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iukc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iukc1 c.23.1.0 (C:1-131) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedl

SCOPe Domain Coordinates for d5iukc1:

Click to download the PDB-style file with coordinates for d5iukc1.
(The format of our PDB-style files is described here.)

Timeline for d5iukc1:

  • d5iukc1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5iukc2