SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i78b1 (5i78 B:31-331)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082782Protein automated matches [190057] (26 species)
    not a true protein
  7. 2082786Species Aspergillus niger [TaxId:5061] [260290] (4 PDB entries)
  8. 2284114Domain d5i78b1: 5i78 B:31-331 [327415]
    Other proteins in same PDB: d5i78a2, d5i78a3, d5i78b2, d5i78b3
    automated match to d1gzja_
    complexed with ca, nag, pge

Details for d5i78b1

PDB Entry: 5i78 (more details), 1.58 Å

PDB Description: crystal structure of a beta-1,4-endoglucanase from aspergillus niger
PDB Compounds: (B:) Endo-beta-1, 4-glucanase

SCOPe Domain Sequences for d5i78b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i78b1 c.1.8.3 (B:31-331) automated matches {Aspergillus niger [TaxId: 5061]}
vfewfgsnesgaefgtnipgvwgtdyifpdpsaistlidkgmnffrvqfmmerllpdsmt
gsydeeylanlttvikavtdggahalvdphnygryngeiisstsdfqtfwenlagqykdn
dlvmfdtnneyhdmdqdlvlnlnqaaingiraagatsqyifvegnswtgawtwvdvndnm
knltdpedkivyemhqyldsdgsgtsetcvsetigkervteatqwlkdnkkvgfigayag
gsndvcrsavsgmleymanntdvwkgaswwaagpwwgdyifsleppdgtaytgmldilea
y

SCOPe Domain Coordinates for d5i78b1:

Click to download the PDB-style file with coordinates for d5i78b1.
(The format of our PDB-style files is described here.)

Timeline for d5i78b1:

  • d5i78b1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22