SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gzea_ (5gze A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (52 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (76 PDB entries)
  8. 2284113Domain d5gzea_: 5gze A: [327414]
    automated match to d4bmea_
    complexed with lat

Details for d5gzea_

PDB Entry: 5gze (more details), 1.32 Å

PDB Description: galectin-8 n-terminal domain carbohydrate recognition domain
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5gzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzea_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsfs

SCOPe Domain Coordinates for d5gzea_:

Click to download the PDB-style file with coordinates for d5gzea_.
(The format of our PDB-style files is described here.)

Timeline for d5gzea_:

  • d5gzea_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22