Lineage for d5kpnb2 (5kpn B:797-1011)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234249Domain d5kpnb2: 5kpn B:797-1011 [327407]
    Other proteins in same PDB: d5kpna1, d5kpna3, d5kpnb1, d5kpnb3
    automated match to d4hhyd2
    complexed with 6wx

Details for d5kpnb2

PDB Entry: 5kpn (more details), 2.3 Å

PDB Description: structure of human parp1 catalytic domain bound to a quinazoline-2, 4(1h,3h)-dione inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5kpnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kpnb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5kpnb2:

Click to download the PDB-style file with coordinates for d5kpnb2.
(The format of our PDB-style files is described here.)

Timeline for d5kpnb2: