SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kpnb2 (5kpn B:797-1011)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2208398Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2284106Domain d5kpnb2: 5kpn B:797-1011 [327407]
    Other proteins in same PDB: d5kpna1, d5kpna3, d5kpnb1, d5kpnb3
    automated match to d4hhyd2
    complexed with 6wx

Details for d5kpnb2

PDB Entry: 5kpn (more details), 2.3 Å

PDB Description: structure of human parp1 catalytic domain bound to a quinazoline-2, 4(1h,3h)-dione inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5kpnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kpnb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5kpnb2:

Click to download the PDB-style file with coordinates for d5kpnb2.
(The format of our PDB-style files is described here.)

Timeline for d5kpnb2:

  • d5kpnb2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22