SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9kf2 (5k9k F:330-501)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2239599Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2239600Protein automated matches [254645] (19 species)
    not a true protein
  7. 2284097Species Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327398] (1 PDB entry)
  8. 2284100Domain d5k9kf2: 5k9k F:330-501 [327401]
    Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf1, d5k9ki1, d5k9kl1, d5k9kl2
    automated match to d1ha0a2
    complexed with bma, man, nag

Details for d5k9kf2

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5k9kf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9kf2 h.3.1.0 (F:330-501) automated matches {Influenza a virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d5k9kf2:

Click to download the PDB-style file with coordinates for d5k9kf2.
(The format of our PDB-style files is described here.)

Timeline for d5k9kf2:

  • d5k9kf2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22