Lineage for d5k9kf1 (5k9k F:4-329)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2284099Domain d5k9kf1: 5k9k F:4-329 [327400]
    Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf2, d5k9ki2, d5k9kl1, d5k9kl2
    automated match to d1ha0a1
    complexed with bma, man, nag

Details for d5k9kf1

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5k9kf1:

Sequence, based on SEQRES records: (download)

>d5k9kf1 b.19.1.2 (F:4-329) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgid
ctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefite
gftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvh
hpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvl
vinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkityg
acpkyvkqntlklatgmrnvpekqtr

Sequence, based on observed residues (ATOM records): (download)

>d5k9kf1 b.19.1.2 (F:4-329) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
pgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgid
ctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefite
gftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvh
hpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvl
vinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkityg
acpkyvkqntlklatgmrnvpekqr

SCOPe Domain Coordinates for d5k9kf1:

Click to download the PDB-style file with coordinates for d5k9kf1.
(The format of our PDB-style files is described here.)

Timeline for d5k9kf1:

  • d5k9kf1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22