SCOPe 2.06: Domain d5k9ki1: 5k9k I:6-328

Lineage for d5k9ki1 (5k9k I:6-328)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (9 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)

8. Domain d5k9ki1: 5k9k I:6-328 [327397]
   Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf2, d5k9ki2, d5k9kl1, d5k9kl2
   automated match to d1ha0a1
   complexed with bma, man, nag

Details for d5k9ki1

PDB Entry: 5k9k, 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.

PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d5k9ki1:

Sequence; same for both SEQRES and ATOM records:

>d5k9ki1 b.19.1.2 (I:6-328) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
ndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidct
lidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegf
twtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhp
stnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvi
nsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygac
pkyvkqntlklatgmrnvpekqt

Timeline for d5k9ki1:

• d5k9ki1 is new in SCOPe 2.06-stable
  
• d5k9ki1 appears in SCOPe 2.07
  
• d5k9ki1 appears in the current release, SCOPe 2.08