![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains) |
![]() | Protein Hemagglutinin [49824] (11 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (121 PDB entries) |
![]() | Domain d5k9ki1: 5k9k I:6-328 [327397] Other proteins in same PDB: d5k9kb1, d5k9kb2, d5k9kf2, d5k9ki2, d5k9kl1, d5k9kl2 automated match to d1ha0a1 complexed with bma, man, nag |
PDB Entry: 5k9k (more details), 2.97 Å
SCOPe Domain Sequences for d5k9ki1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k9ki1 b.19.1.2 (I:6-328) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} ndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidct lidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegf twtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhp stnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvi nsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygac pkyvkqntlklatgmrnvpekqt
Timeline for d5k9ki1: