SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k1ia_ (5k1i A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2014986Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2014987Species Human (Homo sapiens) [TaxId:9606] [89152] (38 PDB entries)
    Uniprot Q08499 388-713
  8. 2284094Domain d5k1ia_: 5k1i A: [327395]
    automated match to d3g4ka_
    complexed with 6pt, mg, zn

Details for d5k1ia_

PDB Entry: 5k1i (more details), 2.61 Å

PDB Description: pde4 crystal structure in complex with small molecule inhibitor
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d5k1ia_:

Sequence, based on SEQRES records: (download)

>d5k1ia_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
lvhpdaqdildtlednrewyqstip

Sequence, based on observed residues (ATOM records): (download)

>d5k1ia_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
ivlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqly
rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
pdaqdildtlednrewyqstip

SCOPe Domain Coordinates for d5k1ia_:

Click to download the PDB-style file with coordinates for d5k1ia_.
(The format of our PDB-style files is described here.)

Timeline for d5k1ia_:

  • d5k1ia_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22