SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kyvb_ (5kyv B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2222614Species Firefly (Photinus pyralis) [TaxId:7054] [193585] (6 PDB entries)
  8. 2284092Domain d5kyvb_: 5kyv B: [327393]
    automated match to d4g36b_
    complexed with slu, tla

Details for d5kyvb_

PDB Entry: 5kyv (more details), 2.5 Å

PDB Description: structure of photinus pyralis luciferase green shifted light emitting variant
PDB Compounds: (B:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d5kyvb_:

Sequence, based on SEQRES records: (download)

>d5kyvb_ e.23.1.1 (B:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvipf
hhafgmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
kggkskl

Sequence, based on observed residues (ATOM records): (download)

>d5kyvb_ e.23.1.1 (B:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvipfhhaf
gmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
edehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaavvvl
ehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakkggk
skl

SCOPe Domain Coordinates for d5kyvb_:

Click to download the PDB-style file with coordinates for d5kyvb_.
(The format of our PDB-style files is described here.)

Timeline for d5kyvb_:

  • d5kyvb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22