Lineage for d5l3ue_ (5l3u E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963595Family d.92.1.2: Thermolysin-like [55490] (5 proteins)
    includes alpha-helical C-terminal domain characteristic for the family
  6. 2963611Protein Thermolysin [63414] (3 species)
  7. 2963612Species Bacillus thermoproteolyticus [TaxId:1427] [55494] (191 PDB entries)
    Uniprot P00800
  8. 2963641Domain d5l3ue_: 5l3u E: [327390]
    automated match to d1kkka_
    complexed with 6ng, ca, dms, zn

Details for d5l3ue_

PDB Entry: 5l3u (more details), 1.23 Å

PDB Description: thermolysin in complex with jc149 (mpd cryo protectant)
PDB Compounds: (E:) thermolysin

SCOPe Domain Sequences for d5l3ue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l3ue_ d.92.1.2 (E:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]}
itgtstvgvgrgvlgdqkninttystyyylqdntrgngiftydakyrttlpgslwadadn
qffasydapavdahyyagvtydyyknvhnrlsydgnnaairssvhysqgynnafwngsqm
vygdgdgqtfiplsggidvvahelthavtdytagliyqnesgaineaisdifgtlvefya
nknpdweigedvytpgisgdslrsmsdpakygdpdhyskrytgtqdnggvhinsgiinka
aylisqggthygvsvvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygsts
qevasvkqafdavgvk

SCOPe Domain Coordinates for d5l3ue_:

Click to download the PDB-style file with coordinates for d5l3ue_.
(The format of our PDB-style files is described here.)

Timeline for d5l3ue_: