Lineage for d1fb6a_ (1fb6 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2131618Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2131684Protein Thioredoxin [52835] (16 species)
  7. 2131880Species Spinach (Spinacia oleracea), thioredoxin M [TaxId:3562] [52841] (3 PDB entries)
  8. 2131881Domain d1fb6a_: 1fb6 A: [32739]

Details for d1fb6a_

PDB Entry: 1fb6 (more details), 2.1 Å

PDB Description: crystal structure of thioredoxin m from spinach chloroplast (oxidized form)
PDB Compounds: (A:) thioredoxin m

SCOPe Domain Sequences for d1fb6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}
vqdvndsswkefvlesevpvmvdfwapwcgpckliapvidelakeysgkiavyklntdea
pgiatqynirsiptvlffkngerkesiigavpkstltdsiekyl

SCOPe Domain Coordinates for d1fb6a_:

Click to download the PDB-style file with coordinates for d1fb6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fb6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fb6b_