SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kyva_ (5kyv A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2222614Species Firefly (Photinus pyralis) [TaxId:7054] [193585] (6 PDB entries)
  8. 2284083Domain d5kyva_: 5kyv A: [327384]
    automated match to d4g36b_
    complexed with slu, tla

Details for d5kyva_

PDB Entry: 5kyv (more details), 2.5 Å

PDB Description: structure of photinus pyralis luciferase green shifted light emitting variant
PDB Compounds: (A:) Luciferin 4-monooxygenase

SCOPe Domain Sequences for d5kyva_:

Sequence, based on SEQRES records: (download)

>d5kyva_ e.23.1.1 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsvipf
hhafgmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidk
ydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavg
kvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdi
aywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaa
vvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak

Sequence, based on observed residues (ATOM records): (download)

>d5kyva_ e.23.1.1 (A:) automated matches {Firefly (Photinus pyralis) [TaxId: 7054]}
aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
esfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvipfhhaf
gmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
edehffivdrlkslikykgyqvapaelesillqhfdagvaglpdddagelpaavvvlktm
tekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak

SCOPe Domain Coordinates for d5kyva_:

Click to download the PDB-style file with coordinates for d5kyva_.
(The format of our PDB-style files is described here.)

Timeline for d5kyva_:

  • d5kyva_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22