Lineage for d5b6ya_ (5b6y A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576670Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2576671Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2576672Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2576677Protein Bacteriorhodopsin [56871] (3 species)
    a light-driven proton pump
  7. 2576682Species Halobacterium salinarum [TaxId:2242] [56873] (91 PDB entries)
    Uniprot P02945 17-245
  8. 2576756Domain d5b6ya_: 5b6y A: [327383]
    automated match to d1qhja_
    complexed with c14, d10, dd9, hp6, l2p, mys, oct, ret, trd, und

Details for d5b6ya_

PDB Entry: 5b6y (more details), 2.1 Å

PDB Description: a three dimensional movie of structural changes in bacteriorhodopsin: structure obtained 36.2 us after photoexcitation
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d5b6ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6ya_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
aypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae

SCOPe Domain Coordinates for d5b6ya_:

Click to download the PDB-style file with coordinates for d5b6ya_.
(The format of our PDB-style files is described here.)

Timeline for d5b6ya_: