Lineage for d5k9kb1 (5k9k B:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2019634Protein automated matches [190119] (22 species)
    not a true protein
  7. 2019694Species Human (Homo sapiens) [TaxId:9606] [188740] (171 PDB entries)
  8. 2284080Domain d5k9kb1: 5k9k B:1-106 [327381]
    Other proteins in same PDB: d5k9kb2, d5k9kf1, d5k9kf2, d5k9ki1, d5k9ki2, d5k9kl2
    automated match to d1dn0a1
    complexed with bma, man, nag

Details for d5k9kb1

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (B:) 56.a.09 light chain

SCOPe Domain Sequences for d5k9kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9kb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvassylawyqqkpgqaprlliygassratgvp
drfsgsgsgtdfiltisrlepedfavyycqqydgsqytfgqgtklei

SCOPe Domain Coordinates for d5k9kb1:

Click to download the PDB-style file with coordinates for d5k9kb1.
(The format of our PDB-style files is described here.)

Timeline for d5k9kb1:

  • d5k9kb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22