Lineage for d5iukf1 (5iuk F:1-132)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (71 species)
    not a true protein
  7. 2101986Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2284078Domain d5iukf1: 5iuk F:1-132 [327379]
    Other proteins in same PDB: d5iukc2, d5iukf2
    automated match to d4le0b_
    complexed with acp, k, mg

Details for d5iukf1

PDB Entry: 5iuk (more details), 2.9 Å

PDB Description: crystal structure of the desk-desr complex in the phosphotransfer state with high mg2+ (150 mm)
PDB Compounds: (F:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iukf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iukf1 c.23.1.0 (F:1-132) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmedly

SCOPe Domain Coordinates for d5iukf1:

Click to download the PDB-style file with coordinates for d5iukf1.
(The format of our PDB-style files is described here.)

Timeline for d5iukf1:

  • d5iukf1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5iukf2