SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrha_ (5jrh A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2284068Species Salmonella typhimurium [TaxId:99287] [327369] (1 PDB entry)
  8. 2284073Domain d5jrha_: 5jrh A: [327374]
    automated match to d2p2qb_
    complexed with bu3, cmp, coa, mg

Details for d5jrha_

PDB Entry: 5jrh (more details), 1.64 Å

PDB Description: crystal structure of salmonella enterica acetyl-coa synthetase (acs) in complex with camp and coenzyme a
PDB Compounds: (A:) Acetyl-coenzyme A synthetase

SCOPe Domain Sequences for d5jrha_:

Sequence, based on SEQRES records: (download)

>d5jrha_ e.23.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
tadegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpk
trsgkimrrilrkiaagdtsnlgdtstladpgvveklleekqa

Sequence, based on observed residues (ATOM records): (download)

>d5jrha_ e.23.1.1 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]}
hkhaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgn
vsikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantl
ldlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvi
tadegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdlieka
spehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywct
advgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairal
maegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmit
plpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherf
eqtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiae
aavvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpk
trsgkimrrilrkiaagdlgdtstladpgvveklleekqa

SCOPe Domain Coordinates for d5jrha_:

Click to download the PDB-style file with coordinates for d5jrha_.
(The format of our PDB-style files is described here.)

Timeline for d5jrha_:

  • d5jrha_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22