SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i4fa1 (5i4f A:1-123)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (25 species)
    not a true protein
  7. 2028399Species Mouse (Mus musculus) [TaxId:10090] [188198] (535 PDB entries)
  8. 2284071Domain d5i4fa1: 5i4f A:1-123 [327372]
    automated match to d4h0hb1
    complexed with 6dm

Details for d5i4fa1

PDB Entry: 5i4f (more details), 1.55 Å

PDB Description: scfv 2d10 complexed with alpha 1,6 mannobiose
PDB Compounds: (A:) scFv 2D10

SCOPe Domain Sequences for d5i4fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4fa1 b.1.1.0 (A:1-123) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
meiqlqqsgpelvkpgasvkisckasgysftdyimlwvkqshgkslewigninpyygsts
ynlkfkgkatltvdkssstaymqlnsltsedsavyycarknyygssldywgqgttltvss
akt

SCOPe Domain Coordinates for d5i4fa1:

Click to download the PDB-style file with coordinates for d5i4fa1.
(The format of our PDB-style files is described here.)

Timeline for d5i4fa1:

  • d5i4fa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-22

View in 3D
Domains from same chain:
(mouse over for more information)
d5i4fa2