Lineage for d5jrhb_ (5jrh B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2284068Species Salmonella typhimurium [TaxId:99287] [327369] (1 PDB entry)
  8. 2284069Domain d5jrhb_: 5jrh B: [327370]
    automated match to d2p2qb_
    complexed with bu3, cmp, coa, mg

Details for d5jrhb_

PDB Entry: 5jrh (more details), 1.64 Å

PDB Description: crystal structure of salmonella enterica acetyl-coa synthetase (acs) in complex with camp and coenzyme a
PDB Compounds: (B:) Acetyl-coenzyme A synthetase

SCOPe Domain Sequences for d5jrhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrhb_ e.23.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
khaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgnv
sikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantll
dlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvit
adegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdliekas
pehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywcta
dvgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairalm
aegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmitp
lpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherfe
qtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiaea
avvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpkt
rsgkimrrilrkiaagdtsnlgdtstladpgvvekllee

SCOPe Domain Coordinates for d5jrhb_:

Click to download the PDB-style file with coordinates for d5jrhb_.
(The format of our PDB-style files is described here.)

Timeline for d5jrhb_:

  • d5jrhb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22