SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jrhb_ (5jrh B:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222543Fold e.23: Acetyl-CoA synthetase-like [56800] (1 superfamily)
    4 domains: (1&2) duplication: share the same alpha/beta fold; (3) beta-barrel; (4) alpha+beta
  4. 2222544Superfamily e.23.1: Acetyl-CoA synthetase-like [56801] (2 families) (S)
  5. 2222545Family e.23.1.1: Acetyl-CoA synthetase-like [56802] (7 protein domains)
  6. 2222613Protein automated matches [193584] (2 species)
    not a true protein
  7. 2284068Species Salmonella typhimurium [TaxId:99287] [327369] (1 PDB entry)
  8. 2284069Domain d5jrhb_: 5jrh B: [327370]
    automated match to d2p2qb_
    complexed with bu3, cmp, coa, mg

Details for d5jrhb_

PDB Entry: 5jrh (more details), 1.64 Å

PDB Description: crystal structure of salmonella enterica acetyl-coa synthetase (acs) in complex with camp and coenzyme a
PDB Compounds: (B:) Acetyl-coenzyme A synthetase

SCOPe Domain Sequences for d5jrhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jrhb_ e.23.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
khaipaniadrclinpeqyetkykqsindpdtfwgeqgkildwitpyqkvkntsfapgnv
sikwyedgtlnlaancldrhlqengdrtaiiwegddtsqskhisyrelhrdvcrfantll
dlgikkgdvvaiympmvpeaavamlacarigavhsvifggfspeavagriidsssrlvit
adegvragrsiplkknvddalknpnvtsvehvivlkrtgsdidwqegrdlwwrdliekas
pehqpeamnaedplfilytsgstgkpkgvlhttggylvyaattfkyvfdyhpgdiywcta
dvgwvtghsyllygplacgattlmfegvpnwptparmcqvvdkhqvnilytaptairalm
aegdkaiegtdrsslrilgsvgepinpeawewywkkigkekcpvvdtwwqtetggfmitp
lpgaielkagsatrpffgvqpalvdneghpqegategnlvitdswpgqartlfgdherfe
qtyfstfknmyfsgdgarrdedgyywitgrvddvlnvsghrlgtaeiesalvahpkiaea
avvgiphaikgqaiyayvtlnhgeepspelyaevrnwvrkeigplatpdvlhwtdslpkt
rsgkimrrilrkiaagdtsnlgdtstladpgvvekllee

SCOPe Domain Coordinates for d5jrhb_:

Click to download the PDB-style file with coordinates for d5jrhb_.
(The format of our PDB-style files is described here.)

Timeline for d5jrhb_:

  • d5jrhb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22