Lineage for d1f9mb_ (1f9m B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876409Species Spinach (Spinacia oleracea), thioredoxin F [TaxId:3562] [52840] (2 PDB entries)
  8. 2876411Domain d1f9mb_: 1f9m B: [32737]
    short form

Details for d1f9mb_

PDB Entry: 1f9m (more details), 1.86 Å

PDB Description: crystal structure of thioredoxin f from spinach chloroplast (short form)
PDB Compounds: (B:) thioredoxin f

SCOPe Domain Sequences for d1f9mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9mb_ c.47.1.1 (B:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]}
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars

SCOPe Domain Coordinates for d1f9mb_:

Click to download the PDB-style file with coordinates for d1f9mb_.
(The format of our PDB-style files is described here.)

Timeline for d1f9mb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f9ma_