Lineage for d5jqra_ (5jqr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002776Protein automated matches [190089] (8 species)
    not a true protein
  7. 2002825Species Soybean (Glycine max) [TaxId:3847] [187116] (19 PDB entries)
  8. 2284067Domain d5jqra_: 5jqr A: [327368]
    automated match to d2y6ba_
    complexed with hem, k, so4

Details for d5jqra_

PDB Entry: 5jqr (more details), 1.81 Å

PDB Description: the structure of ascorbate peroxidase compound ii formed by reaction with m-cpba
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d5jqra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jqra_ a.93.1.1 (A:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfada

SCOPe Domain Coordinates for d5jqra_:

Click to download the PDB-style file with coordinates for d5jqra_.
(The format of our PDB-style files is described here.)

Timeline for d5jqra_:

  • d5jqra_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22