Lineage for d5jpra_ (5jpr A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328248Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2328249Protein Ascorbate peroxidase [48123] (3 species)
  7. 2328255Species Soybean (Glycine max) [TaxId:3847] [89092] (12 PDB entries)
    Uniprot Q43758
  8. 2328264Domain d5jpra_: 5jpr A: [327367]
    automated match to d1oaga_
    complexed with dod, hem, k, so4

Details for d5jpra_

PDB Entry: 5jpr (more details), 1.81 Å

PDB Description: neutron structure of compound ii of ascorbate peroxidase
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d5jpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpra_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d5jpra_:

Click to download the PDB-style file with coordinates for d5jpra_.
(The format of our PDB-style files is described here.)

Timeline for d5jpra_: