SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jpra_ (5jpr A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002467Protein Ascorbate peroxidase [48123] (3 species)
  7. 2002473Species Soybean (Glycine max) [TaxId:3847] [89092] (10 PDB entries)
    Uniprot Q43758
  8. 2284066Domain d5jpra_: 5jpr A: [327367]
    automated match to d1oaga_
    complexed with dod, hem, k, so4

Details for d5jpra_

PDB Entry: 5jpr (more details), 1.81 Å

PDB Description: neutron structure of compound ii of ascorbate peroxidase
PDB Compounds: (A:) ascorbate peroxidase

SCOPe Domain Sequences for d5jpra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jpra_ a.93.1.1 (A:) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

SCOPe Domain Coordinates for d5jpra_:

Click to download the PDB-style file with coordinates for d5jpra_.
(The format of our PDB-style files is described here.)

Timeline for d5jpra_:

  • d5jpra_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22