Lineage for d1f9ma_ (1f9m A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395824Family c.47.1.1: Thioltransferase [52834] (9 proteins)
  6. 395871Protein Thioredoxin [52835] (9 species)
  7. 395945Species Spinach (Spinacia oleracea), thioredoxin F [TaxId:3562] [52840] (2 PDB entries)
  8. 395946Domain d1f9ma_: 1f9m A: [32736]

Details for d1f9ma_

PDB Entry: 1f9m (more details), 1.86 Å

PDB Description: crystal structure of thioredoxin f from spinach chloroplast (short form)

SCOP Domain Sequences for d1f9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F}
meaivgkvtevnkdtfwpivkaagdkpvvldmftqwcgpckamapkyeklaeeyldvifl
kldcnqenktlakelgirvvptfkilkensvvgevtgakydklleaiqaars

SCOP Domain Coordinates for d1f9ma_:

Click to download the PDB-style file with coordinates for d1f9ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f9ma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1f9mb_