SCOPe 2.08: Domain d5c34b_: 5c34 B:

Lineage for d5c34b_ (5c34 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.1: Resolvase-like [53041] (2 families)
   automatically mapped to Pfam PF00239

5. Family c.53.1.0: automated matches [227230] (1 protein)
   not a true family

6. Protein automated matches [226976] (3 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)

8. Domain d5c34b_: 5c34 B: [327359]
   automated match to d2rslb_
   complexed with so4

Details for d5c34b_

PDB Entry: 5c34, 2.66 Å

PDB Description: constitutively active sin recombinase cataltyic domain - i100t/q115r

PDB Compounds: (B:) Putative transposon Tn552 DNA-invertase bin3

SCOPe Domain Sequences for d5c34b_:

Sequence, based on SEQRES records:

>d5c34b_ c.53.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevtgnplldkfmkdliirilamv
seqe

Sequence, based on observed residues (ATOM records):

>d5c34b_ c.53.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekpilqkalnfvemgdrfivesidrlgr
nynevihtvnylkdkevqlmitslpmmnevtgnplldkfmkdliirilamvseqe

Timeline for d5c34b_:

• d5c34b_ first appeared in SCOPe 2.06
  
• d5c34b_ appears in SCOPe 2.07