SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2pa_ (5h2p A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225114Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2225115Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2225116Family f.13.1.1: Bacteriorhodopsin-like [81319] (6 protein domains)
  6. 2225121Protein Bacteriorhodopsin [56871] (2 species)
    a light-driven proton pump
  7. 2225126Species Halobacterium salinarum [TaxId:2242] [56873] (83 PDB entries)
    Uniprot P02945 17-245
  8. 2284055Domain d5h2pa_: 5h2p A: [327356]
    automated match to d1qhja_
    complexed with c14, d10, dd9, hp6, l2p, mys, oct, ret, trd, und

Details for d5h2pa_

PDB Entry: 5h2p (more details), 2.1 Å

PDB Description: a three dimensional movie of structural changes in bacteriorhodopsin: structure obtained 657 us after photoexcitation
PDB Compounds: (A:) bacteriorhodopsin

SCOPe Domain Sequences for d5h2pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h2pa_ f.13.1.1 (A:) Bacteriorhodopsin {Halobacterium salinarum [TaxId: 2242]}
itgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllg
ygltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtgl
vgaltkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlws
aypvvwligsegagivplnietllfmvldvsakvgfglillrsraifgeae

SCOPe Domain Coordinates for d5h2pa_:

Click to download the PDB-style file with coordinates for d5h2pa_.
(The format of our PDB-style files is described here.)

Timeline for d5h2pa_:

  • d5h2pa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22