Lineage for d1quwa_ (1quw A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24141Species Bacillus acidocaldarius [52839] (1 PDB entry)
  8. 24142Domain d1quwa_: 1quw A: [32735]

Details for d1quwa_

PDB Entry: 1quw (more details)

PDB Description: solution structure of the thioredoxin from bacillus acidocaldarius

SCOP Domain Sequences for d1quwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1quwa_ c.47.1.1 (A:) Thioredoxin {Bacillus acidocaldarius}
atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggrpvkqligyqpkeqleaqladvlq

SCOP Domain Coordinates for d1quwa_:

Click to download the PDB-style file with coordinates for d1quwa_.
(The format of our PDB-style files is described here.)

Timeline for d1quwa_: