Lineage for d5gzca_ (5gzc A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044265Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2284042Domain d5gzca_: 5gzc A: [327343]
    automated match to d4bmea_
    complexed with gol, na

Details for d5gzca_

PDB Entry: 5gzc (more details), 1.08 Å

PDB Description: crystal structure of galectin-8 n-crd with part of linker
PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d5gzca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gzca_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpradvafhf
nprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtlly
ghrigpekidtlgiygkvnihsigfsfssdlq

SCOPe Domain Coordinates for d5gzca_:

Click to download the PDB-style file with coordinates for d5gzca_.
(The format of our PDB-style files is described here.)

Timeline for d5gzca_:

  • d5gzca_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22