SCOP 1.71: Domain d1dbya_: 1dby A:

Lineage for d1dbya_ (1dby A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (16 families)

5. Family c.47.1.1: Thioltransferase [52834] (13 proteins)

6. Protein Thioredoxin [52835] (12 species)

7. Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries)

8. Domain d1dbya_: 1dby A: [32734]

Details for d1dbya_

PDB Entry: 1dby

PDB Description: nmr structures of chloroplast thioredoxin m ch2 from the green alga chlamydomonas reinhardtii

SCOP Domain Sequences for d1dbya_:

Sequence; same for both SEQRES and ATOM records:

>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii}
meagavnddtfknvvlessvpvlvdfwapwcgpcriiapvvdeiageykdklkcvklntd
espnvaseygirsiptimvfkggkkcetiigavpkativqtvekyln

Timeline for d1dbya_:

• d1dbya_ first appeared (with stable ids) in SCOP 1.55
  
• d1dbya_ appears in SCOP 1.69
  
• d1dbya_ appears in SCOP 1.73
  
• d1dbya_ appears in the current release, SCOPe 2.08, called d1dbya1