SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5c34c_ (5c34 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121765Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2121766Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2121790Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2121791Protein automated matches [226976] (3 species)
    not a true protein
  7. 2121795Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)
  8. 2284037Domain d5c34c_: 5c34 C: [327338]
    automated match to d2rslb_
    complexed with so4

Details for d5c34c_

PDB Entry: 5c34 (more details), 2.66 Å

PDB Description: constitutively active sin recombinase cataltyic domain - i100t/q115r
PDB Compounds: (C:) Putative transposon Tn552 DNA-invertase bin3

SCOPe Domain Sequences for d5c34c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c34c_ c.53.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevtgnplldkfmkdliirilamv
seqe

SCOPe Domain Coordinates for d5c34c_:

Click to download the PDB-style file with coordinates for d5c34c_.
(The format of our PDB-style files is described here.)

Timeline for d5c34c_:

  • d5c34c_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22