Lineage for d5ffxb_ (5ffx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984566Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 1984570Domain d5ffxb_: 5ffx B: [327334]
    automated match to d4llla_
    complexed with gol, so4; mutant

Details for d5ffxb_

PDB Entry: 5ffx (more details), 1.47 Å

PDB Description: s. aureus mepr g34k mutant
PDB Compounds: (B:) MarR family regulatory protein

SCOPe Domain Sequences for d5ffxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ffxb_ a.4.5.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqkhtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

SCOPe Domain Coordinates for d5ffxb_:

Click to download the PDB-style file with coordinates for d5ffxb_.
(The format of our PDB-style files is described here.)

Timeline for d5ffxb_: