SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gy3a_ (5gy3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2284030Species Klebsiella pneumoniae [TaxId:573] [327331] (1 PDB entry)
  8. 2284031Domain d5gy3a_: 5gy3 A: [327332]
    automated match to d1wzza1

Details for d5gy3a_

PDB Entry: 5gy3 (more details), 1.77 Å

PDB Description: the crystal structure of endoglucanase cel10, a family 8 glycosyl hydrolase from klebsiella pneumoniae
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5gy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gy3a_ a.102.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dtawerykarfmmpdgriidtangnvshtegqgfamllavanndrpafdklwqwtdstlr
dksnglfywrynpvapdpiadknnasdgdtliawallraqkqwqdkryaiasdaitasll
kytvvtfagrqvmlpgvkgfnlndhlnlnpsyfifpawrafaerthltawrtlqtdgqal
lgqmgwgkshlpsdwvalradgkmlpakewpprmsfdairiplylswadpqsallapwka
wmqsyprlqtpawinvstnevapwymaggllavrdltlgepqeapqiddkddyysaslkq
lvwlakqdqr

SCOPe Domain Coordinates for d5gy3a_:

Click to download the PDB-style file with coordinates for d5gy3a_.
(The format of our PDB-style files is described here.)

Timeline for d5gy3a_:

  • d5gy3a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22