Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) |
Family c.47.1.1: Thioltransferase [52834] (9 proteins) |
Protein Thioredoxin [52835] (9 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [52838] (4 PDB entries) |
Domain d1tof__: 1tof - [32733] |
PDB Entry: 1tof (more details)
SCOP Domain Sequences for d1tof__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tof__ c.47.1.1 (-) Thioredoxin {Chlamydomonas reinhardtii} ggsvividskaawdaqlakgkeehkpivvdftatwcgpckmiaplfetlsndyagkvifl kvdvdavaavaeaagitamptfhvykdgvkaddlvgasqdklkalvakhaaa
Timeline for d1tof__: