SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fdba_ (5fdb A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070498Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 protein domains)
    Pfam PF05995, CDO_I
  6. 2070499Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2070505Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)
  8. 2284024Domain d5fdba_: 5fdb A: [327325]
    automated match to d3elna_

Details for d5fdba_

PDB Entry: 5fdb (more details), 1.75 Å

PDB Description: iron free rat cysteine dioxygenase r60qc164r variant
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d5fdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdba_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytqnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtrhafdqrtghknkvtmtfhs
kfgirtp

SCOPe Domain Coordinates for d5fdba_:

Click to download the PDB-style file with coordinates for d5fdba_.
(The format of our PDB-style files is described here.)

Timeline for d5fdba_:

  • d5fdba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22