Lineage for d5fdba_ (5fdb A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070498Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 protein domains)
    Pfam PF05995, CDO_I
  6. 2070499Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2070505Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (51 PDB entries)
  8. 2284024Domain d5fdba_: 5fdb A: [327325]
    automated match to d3elna_

Details for d5fdba_

PDB Entry: 5fdb (more details), 1.75 Å

PDB Description: iron free rat cysteine dioxygenase r60qc164r variant
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d5fdba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fdba_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytqnlv
dqgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikkser
tlrenqcayindsiglhrvenvshtepavslhlysppfdtrhafdqrtghknkvtmtfhs
kfgirtp

SCOPe Domain Coordinates for d5fdba_:

Click to download the PDB-style file with coordinates for d5fdba_.
(The format of our PDB-style files is described here.)

Timeline for d5fdba_:

  • d5fdba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22