Lineage for d5c31f_ (5c31 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883014Superfamily c.53.1: Resolvase-like [53041] (2 families) (S)
    automatically mapped to Pfam PF00239
  5. 2883038Family c.53.1.0: automated matches [227230] (1 protein)
    not a true family
  6. 2883039Protein automated matches [226976] (3 species)
    not a true protein
  7. 2883043Species Staphylococcus aureus [TaxId:1280] [226158] (5 PDB entries)
  8. 2883069Domain d5c31f_: 5c31 F: [327321]
    automated match to d2rslb_
    complexed with so4

Details for d5c31f_

PDB Entry: 5c31 (more details), 3.1 Å

PDB Description: constitutively active sin recombinase catalytic domain reveals two rotational intermediates
PDB Compounds: (F:) Sin, putative plasmid resolvase dimer

SCOPe Domain Sequences for d5c31f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c31f_ c.53.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]}
miigyarvssldqnlerqlenlktfgaekiftekqsgksienrpilqkalnfvemgdrfi
vesidrlgrnynevihtvnylkdkevqlmitslpmmnevignplldkfmkdlviqilamv
seqer

SCOPe Domain Coordinates for d5c31f_:

Click to download the PDB-style file with coordinates for d5c31f_.
(The format of our PDB-style files is described here.)

Timeline for d5c31f_: